General Information

  • ID:  hor001910
  • Uniprot ID:  P09686
  • Protein name:  Glucagon-like peptide
  • Gene name:  gcg
  • Organism:  Myoxocephalus scorpius (Shorthorn sculpin) (Cottus scorpius)
  • Family:  Glucagon family
  • Source:  animal
  • Expression:  Produced in the A cells of the islets of Langerhans in response to a drop in blood sugar concentration.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Myoxocephalus (genus), Cottidae (family), Cottales (infraorder), Cottioidei (suborder), Perciformes (order), Eupercaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0050896 response to stimulus
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  HADGTFTSDVSSYLNDQAIKDFVAKLKSGKV
  • Length:  31
  • Propeptide:  LQDAEDSSRFDADDTLAGEARELSTPKXHSEGTFSNDYSKYLETRRAQDFVQWLKNSXXXXXXXXHADGTFTSDVSSYLNDQAIKDFVAKLKSGKV
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Promotes hydrolysis of glycogen and lipids, and raises the blood sugar level.
  • Mechanism:  X's in the sequence were included by homology with American goosefish sequences.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor001910_AF2.pdbhor001910_ESM.pdb

Physical Information

Mass: 387801 Formula: C148H233N39O49
Absent amino acids: CEMPRW Common amino acids: DKS
pI: 7.54 Basic residues: 5
Polar residues: 10 Hydrophobic residues: 11
Hydrophobicity: -34.84 Boman Index: -5265
Half-Life: 3.5 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 75.48
Instability Index: -173.23 Extinction Coefficient cystines: 1490
Absorbance 280nm: 49.67

Literature

  • PubMed ID:  3549298
  • Title:  Primary structures of three fragments of proglucagon from the pancreatic islets of the daddy Sculpin (Cottus scorpius).